product-hunt-mailer
A Python CLI tool that fetches Product Hunt's daily top launches, generates AI-powered summaries using Gemini, and sends a beautifully formatted email digest via Resend.
000Python
ai-daily-newsai-toolsdaily-tasksemailernewsletterproducthunt
Last updated:
š Product Hunt Daily Emailer
A Python CLI tool that fetches Product Hunt's daily top launches, generates AI-powered summaries using Gemini, and sends a beautifully formatted email digest via Resend.
⨠Features
- š Scrapes top products from Product Hunt homepage
- š¤ AI-powered summaries using Gemini 3 Flash Preview (free tier)
- š§ Beautiful HTML email templates
- āļø YAML-based configuration
- š Raspberry Pi cron job ready
ā” One-Line Install (Raspberry Pi / Linux)
curl -fsSL https://raw.githubusercontent.com/eyupucmaz/product-hunt-mailer/main/install.sh | bashThis interactive script will:
- Install
uvpackage manager - Clone the repository
- Configure your API keys and email settings
- Set up a cron job for scheduled emails
š Prerequisites
- Python 3.10+
- uv package manager
- Gemini API key (free)
- Resend API key (free tier available)
š Manual Setup
1. Clone the repository
git clone https://github.com/eyupucmaz/product-hunt-mailer.git
cd product-hunt-mailer2. Install dependencies
# Install uv if you haven't
curl -LsSf https://astral.sh/uv/install.sh | sh
# Install project dependencies
uv sync3. Configure environment variables
cp .env.example .envEdit .env and add your API keys:
GEMINI_API_KEY=your_gemini_api_key_here
RESEND_API_KEY=your_resend_api_key_here4. Configure email settings
cp config.example.yaml config.yamlEdit config.yaml to set your recipients and sender email:
email:
from: "Product Hunt Digest <digest@yourdomain.com>"
subject_prefix: "š Product Hunt Daily"
recipients:
- name: "Your Name"
email: "you@example.com"Note: The sender email domain must be verified in your Resend dashboard.
5. Run
uv run python -m src.mainš Raspberry Pi Deployment
Install uv on Raspberry Pi
curl -LsSf https://astral.sh/uv/install.sh | sh
source $HOME/.local/bin/envClone and Setup
cd ~
git clone https://github.com/eyupucmaz/product-hunt-mailer.git
cd product-hunt-mailer
uv sync
cp .env.example .env
cp config.example.yaml config.yaml
# Edit both files with your settingsTest
uv run python -m src.mainSetup Cron Job
crontab -eAdd one of these lines:
# Daily at 9:00 AM
0 9 * * * cd /home/pi/product-hunt-mailer && /home/pi/.local/bin/uv run python -m src.main >> /home/pi/product-hunt-mailer/cron.log 2>&1
# Daily at 8:00 AM and 6:00 PM
0 8,18 * * * cd /home/pi/product-hunt-mailer && /home/pi/.local/bin/uv run python -m src.main >> /home/pi/product-hunt-mailer/cron.log 2>&1
# Weekdays only at 9:00 AM
0 9 * * 1-5 cd /home/pi/product-hunt-mailer && /home/pi/.local/bin/uv run python -m src.main >> /home/pi/product-hunt-mailer/cron.log 2>&1Note: Replace
/home/piwith your actual home directory (echo $HOME)
š Project Structure
product-hunt-mailer/
āāā .env.example # Environment variables template
āāā config.example.yaml # Configuration template
āāā pyproject.toml # Dependencies
āāā README.md
āāā src/
āāā __init__.py
āāā main.py # CLI entry point
āāā scraper.py # Product Hunt scraper
āāā summarizer.py # Gemini AI integration
āāā mailer.py # Resend email sender
āļø Configuration Options
config.yaml
| Option | Description |
|---|---|
email.from | Sender email (must be verified in Resend) |
email.subject_prefix | Email subject prefix |
recipients | List of recipients with name and email |
settings.product_count | Number of products to include (1-10) |
gemini.model | Gemini model to use |
Gemini Models
| Model | Description |
|---|---|
gemini-3-flash-preview | Latest, fastest, recommended (free) |
gemini-2.5-flash | Previous generation (free) |
š§ Troubleshooting
| Issue | Solution |
|---|---|
403 Forbidden | The scraper uses browser impersonation to bypass bot detection. If issues persist, try updating curl_cffi. |
GEMINI_API_KEY required | Make sure .env file exists and contains your API key (uncommented) |
| Cron not running | Use absolute paths for uv in crontab. Check with which uv |
| No email received | Check Resend dashboard for delivery status. Verify sender domain. |
š License
MIT License - feel free to use this for your own projects!
š Credits
- Product Hunt for the amazing product discovery platform
- Google Gemini for AI summarization
- Resend for email delivery